Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-CX3CL1 (Fractalkine) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant human Fractalkine |
Rabbit Polyclonal CX3CL1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CX3CL1 antibody was raised against a peptide corresponding to 18 amino acids near the amino terminus of human CX3CL1 . |
Anti-Human Fractalkine Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human Fractalkine (CX3CL1) |
CX3CL1 / fractalkine (aa214-226) Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Internal region (KTSEAPSTQDPST) |
Rabbit Polyclonal Anti-CX3CL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CX3CL1 antibody is: synthetic peptide directed towards the middle region of Human CX3CL1. Synthetic peptide located within the following region: APHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQ |
Anti-CX3CL1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 368-381 amino acids of Human chemokine (C-X3-C motif) ligand 1 |
CX3CL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CX3CL1 |
CX3CL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CX3CL1 |
Active filters
Target Symbol
- CX3CL1