Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-CXADR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CXADR |
Rabbit polyclonal anti-CXADR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CXADR. |
Rabbit Polyclonal Anti-CXADR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CXADR Antibody: synthetic peptide directed towards the N terminal of human CXADR. Synthetic peptide located within the following region: ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCK |
Rabbit Polyclonal Anti-CXADR Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXADR antibody was raised against synthetic 15 amino acid peptide from internal region of human CXADR. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Zebra finch, Platypus, Lizard (93%); Xenopus, Stickleback, Pufferfish, Zebrafish (80%). |
Rabbit Polyclonal Anti-CXADR Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | CXADR antibody was raised against synthetic 15 amino acid peptide from internal region of human CXADR. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%); Monkey, Galago, Horse (93%); Marmoset, Mouse, Elephant, Panda, Bat, Bovine, Rabbit, Pig, Guinea pig (87%); Rat, Hamster (80%). |
CXADR Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse CXADR |
Active filters
Target Symbol
- CXADR