Rabbit Polyclonal Anti-CXCL16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCL16 antibody: synthetic peptide directed towards the C terminal of human CXCL16. Synthetic peptide located within the following region: TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV |
Biotinylated Anti-Human CXCL16 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human CXCL16 |
CXCL16 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CXCL16 |
Germany
Japan
United Kingdom
China
