Antibodies

Jump to Filters
View as table Download
MIG (CXCL9) Rabbit Polyclonal Antibody
TA328386

USD 285.00

5 Days

Anti-Human MIG Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MIG (CXCL9)
MIG (CXCL9) Rabbit Polyclonal Antibody
TA330378

USD 375.00

5 Days

Rabbit Polyclonal Anti-CXCL9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL9 antibody: synthetic peptide directed towards the middle region of human CXCL9. Synthetic peptide located within the following region: QTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQ
MIG (CXCL9) Rabbit Polyclonal Antibody
TA375248

USD 220.00

3 Weeks

CXCL9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human CXCL9 (NP_002407.1).
Modifications Unmodified