Antibodies

Jump to Filters
View as table Download
CYB5R4 Rabbit Polyclonal Antibody
TA345051

USD 475.00

5 Days

Rabbit Polyclonal Anti-CYB5R4 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cyb5r4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PSQAFPAPGSQQRVSSQGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGGL
Cyb5r4 Goat Polyclonal Antibody
TA311518

USD 375.00

5 Days

Goat Anti-Cyb5r4 (mouse aa444-458) Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide with sequence RCQLEKLALREKRFD, from the internal region of the protein sequence according to NP_077157.2.
CYB5R4 Rabbit Polyclonal Antibody
TA365707

USD 380.00

4 Weeks

CYB5R4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CYB5R4