Antibodies

Jump to Filters
View as table Download
Cytohesin 2 (CYTH2) Rabbit Polyclonal Antibody
TA590845

USD 409.00

In Stock

Rabbit Polyclonal Cytohesin 2 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
Cytohesin 2 (CYTH2) (N-term) Rabbit Polyclonal Antibody
AP53479PU-N

USD 450.00

2 Weeks

Cytohesin 2 (CYTH2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 35-64 amino acids from the N-terminal region of Human Cytohesin 2 (N-term).
Cytohesin 2 (CYTH2) Goat Polyclonal Antibody
TA303303

USD 375.00

5 Days

Goat Polyclonal Antibody against PSCD2

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence EDGVYEPPDLTP-C, from the N Terminus of the protein sequence according to NP_004219.2; NP_059431.1.
Cytohesin 2 (CYTH2) Rabbit Polyclonal Antibody
TA335544

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYTH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYTH2 Antibody is: synthetic peptide directed towards the C-terminal region of Human CYTH2. Synthetic peptide located within the following region: GRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPN
Cytohesin 2 (CYTH2) Mouse Monoclonal Antibody [Clone ID: OTI4D9]
CF809012

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CYTH2 mouse monoclonal antibody,clone OTI4D9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated