Antibodies

View as table Download

Rabbit Polyclonal Anti-Daam2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Daam2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Daam2. Synthetic peptide located within the following region: RFAELVDELDLTDKNREAVFALPPEKKWQIYCSKRKEQEDPNKLATSWP

DAAM2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human DAAM2 (NP_056160.2).
Modifications Unmodified