Antibodies

View as table Download

Rabbit Polyclonal Anti-DACH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DACH1 antibody: synthetic peptide directed towards the N terminal of human DACH1. Synthetic peptide located within the following region: MAVPAALIPPTQLVPPQPPISTSASSSGTTTSTSSATSSPAPSIGPPASS

Rabbit Polyclonal Anti-DACH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DACH1 antibody: synthetic peptide directed towards the C terminal of human DACH1. Synthetic peptide located within the following region: TLKQAASTDSLRVLNDSLTPEIEADRSGGRTDAERTIQDGRLYLKTTVMY

Rabbit Polyclonal DACH1 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Goat Polyclonal Antibody against DACH1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence SPVENTPQNNECK, from the internal region of the protein sequence according to NP_542937.1; NP_542938.1; NP_004383.2.

Rabbit Polyclonal Anti-DACH1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DACH1

DACH1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DACH1

DACH1 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified