Antibodies

View as table Download

Goat Polyclonal Antibody against DACH2

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-TRKQAVNSSRPGR, from the internal region of the protein sequence according to NP_444511.1.

Rabbit Polyclonal Anti-DACH2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DACH2 antibody: synthetic peptide directed towards the C terminal of human DACH2. Synthetic peptide located within the following region: TKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNG

Rabbit Polyclonal Anti-DACH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DACH2 antibody is: synthetic peptide directed towards the C-terminal region of Human DACH2. Synthetic peptide located within the following region: QALKQATTSDSGLRMLKDTGIPDIEIENNGTPHDSAAMQGGNYYCLEMAQ

Rabbit Polyclonal Anti-DACH2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DACH2

DACH2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DACH2