Antibodies

Jump to Filters
View as table Download
DARS (N-term) Rabbit Polyclonal Antibody
AP51185PU-N

USD 450.00

2 Weeks

DARS (N-term) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 161-190 amino acids from the N-terminal region of Human DARS.
DARS1 Rabbit Polyclonal Antibody
TA330912

USD 375.00

5 Days

Rabbit Polyclonal Anti-DARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DARS antibody is: synthetic peptide directed towards the C-terminal region of Human DARS. Synthetic peptide located within the following region: LAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHH
DARS1 Rabbit Polyclonal Antibody
TA375324

USD 220.00

3 Weeks

DARS Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 222-501 of human DARS (NP_001340.2).
Modifications Unmodified