Antibodies

View as table Download

Rabbit anti-DBI Polyclonal Antibody

Applications ELISA, IP, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-DBI Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DBI Antibody: synthetic peptide directed towards the N terminal of human DBI. Synthetic peptide located within the following region: MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDF

Rabbit polyclonal anti Anxiety Peptide; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated

Rabbit polyclonal anti Anxiety Peptide; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated

DBI Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified