Antibodies

View as table Download

Rabbit Polyclonal Anti-DBP Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DBP antibody: synthetic peptide directed towards the middle region of human DBP. Synthetic peptide located within the following region: VRRASGCLITLDQHNGKKSQAVESANTAHNGKVNGLCFTSDGLHLLTVGT

Rabbit Polyclonal Anti-DBP Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DBP antibody: synthetic peptide directed towards the C terminal of human DBP. Synthetic peptide located within the following region: FSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLK

Rabbit Polyclonal Anti-DBP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DBP antibody: synthetic peptide directed towards the N terminal of human DBP. Synthetic peptide located within the following region: PKEPASCLLKEKERKAALPAATTPGPGLETAGPADAPAGAVVGGGSPRGR

Rabbit Polyclonal anti-DBP antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DBP antibody: synthetic peptide directed towards the middle region of human DBP. Synthetic peptide located within the following region: SSPGHAPARAALGTASGHRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLA

DBP rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DBP

DBP Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-325 of human DBP (NP_001343.2).
Modifications Unmodified