Germany
Japan
United Kingdom
China
Antibodies
View as table Download
DCAF12 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 222-252 amino acids from the Central region of human WDR40A |
Rabbit Polyclonal Anti-DCAF12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDR40A antibody: synthetic peptide directed towards the middle region of human WDR40A. Synthetic peptide located within the following region: TKSDARHNVSRVPVYAHITHKALKDIPKEDTNPDNCKVRALAFNNKNKEL |
Rabbit Polyclonal Anti-DCAF12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDR40A antibody: synthetic peptide directed towards the N terminal of human WDR40A. Synthetic peptide located within the following region: ARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLK |
DCAF12 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human DCAF12 (NP_056212.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DCAF12