Antibodies

View as table Download

DCAF12 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human DCAF12

Chicken Polyclonal TCC52 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TCC52 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human TCC52.

DCAF12 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 222-252 amino acids from the Central region of human WDR40A

Rabbit Polyclonal Anti-DCAF12

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WDR40A antibody: synthetic peptide directed towards the middle region of human WDR40A. Synthetic peptide located within the following region: TKSDARHNVSRVPVYAHITHKALKDIPKEDTNPDNCKVRALAFNNKNKEL

Rabbit Polyclonal Anti-DCAF12

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WDR40A antibody: synthetic peptide directed towards the N terminal of human WDR40A. Synthetic peptide located within the following region: ARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLK

DCAF12 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human DCAF12 (NP_056212.1).
Modifications Unmodified