Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-DCN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCN antibody: synthetic peptide directed towards the N terminal of human DCN. Synthetic peptide located within the following region: IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL |
Rabbit Polyclonal Anti-DCN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCN antibody: synthetic peptide directed towards the C terminal of human DCN. Synthetic peptide located within the following region: FCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK |
Rabbit polyclonal anti-Decorin antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 130 of human Decorin |
Rabbit polyclonal anti-Decorin antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 130 of human Decorin |
Decorin (DCN) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human DCN |
Decorin (DCN) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human Decorin |
Goat Anti-Decorin Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KISRVDAASLKGLNN, from the internal region of the protein sequence according to NP_001911.1; NP_598011.1; NP_598012.1;. |
DCN Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse DCN |
DCN Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 31-359 of human DCN (NP_598010.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DCN