Antibodies

View as table Download

DCN Rabbit Polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-DCN Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DCN

Rabbit Polyclonal Anti-DCN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCN antibody: synthetic peptide directed towards the N terminal of human DCN. Synthetic peptide located within the following region: IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL

Rabbit Polyclonal Anti-DCN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCN antibody: synthetic peptide directed towards the C terminal of human DCN. Synthetic peptide located within the following region: FCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

Rabbit Polyclonal Decorin Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal anti-Decorin antibody

Applications WB
Reactivities Human, Mouse, Rabbit, Rat, Pig
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 130 of human Decorin

Rabbit polyclonal anti-Decorin antibody

Applications WB
Reactivities Human, Mouse, Rabbit, Rat, Pig
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 130 of human Decorin

Decorin (DCN) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human DCN

Decorin (DCN) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human Decorin

Goat Anti-Decorin Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KISRVDAASLKGLNN, from the internal region of the protein sequence according to NP_001911.1; NP_598011.1; NP_598012.1;.

DCN Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse DCN

DCN Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified