Antibodies

Jump to Filters
View as table Download
DCSTAMP Rabbit Polyclonal Antibody
TA339561

USD 375.00

5 Days

Rabbit Polyclonal Anti-DCSTAMP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TM7SF4 antibody: synthetic peptide directed towards the N terminal of human TM7SF4. Synthetic peptide located within the following region: AGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQW
DCSTAMP Rabbit Polyclonal Antibody
TA375356

USD 220.00

3 Weeks

DCSTAMP Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 401-470 of human DCSTAMP (NP_110415.1).
Modifications Unmodified