DCUN1D3 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DCUN1D3 |
DCUN1D3 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DCUN1D3 |
Rabbit Polyclonal Anti-DCUN1D3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DCUN1D3 antibody: synthetic peptide directed towards the N terminal of human DCUN1D3. Synthetic peptide located within the following region: GHREEQVPPCGKPGGDILVNGTKKAEAATEACQLPTSSGDAGRESKSNAE |
Rabbit Polyclonal Anti-DCUN1D3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DCUN1D3 antibody: synthetic peptide directed towards the C terminal of human DCUN1D3. Synthetic peptide located within the following region: LNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFV |