Rabbit Polyclonal Anti-DDAH2 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDAH2 antibody: synthetic peptide directed towards the N terminal of human DDAH2. Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG |
Goat Polyclonal Antibody against DDAH2
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SSLCLVLSTRPHS, from the C Terminus of the protein sequence according to NP_039268.1. |
DDAH2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-285 of human DDAH2 (NP_039268.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
