Rabbit Polyclonal Anti-DDIT4L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDIT4L antibody: synthetic peptide directed towards the middle region of human DDIT4L. Synthetic peptide located within the following region: KLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKL |
Rabbit Polyclonal Anti-DDIT4L Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DDIT4L |
DDIT4L rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DDIT4L |
Germany
Japan
United Kingdom
China