DDT rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DDT |
DDT rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DDT |
Rabbit polyclonal antibody to DDT (D-dopachrome tautomerase)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 118 of DDT (Uniprot ID#P30046) |
Rabbit Polyclonal Anti-DDT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DDT antibody: synthetic peptide directed towards the N terminal of human DDT. Synthetic peptide located within the following region: PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS |
Carrier-free (BSA/glycerol-free) DDT mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DDT mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DDT mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DDT mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DDT mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DDT mouse monoclonal antibody,clone OTI3A1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DDT mouse monoclonal antibody,clone OTI1F12
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DDT mouse monoclonal antibody,clone OTI2H3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
DDT rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DDT |
DDT Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human DDT (NP_001346.1). |
Modifications | Unmodified |
DDT mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
DDT mouse monoclonal antibody,clone 1B1, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
DDT mouse monoclonal antibody,clone 1B1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
DDT mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
DDT mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
DDT mouse monoclonal antibody,clone 3B10, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
DDT mouse monoclonal antibody,clone 3B10, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
DDT mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
DDT mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
DDT mouse monoclonal antibody,clone 3A11, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
DDT mouse monoclonal antibody,clone 3A11, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
DDT mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
DDT mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
DDT mouse monoclonal antibody, clone OTI1A1 (formerly 1A1), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Biotin |
DDT mouse monoclonal antibody, clone OTI1A1 (formerly 1A1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | HRP |
DDT mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
DDT mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
DDT mouse monoclonal antibody,clone 1H3, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Biotin |
DDT mouse monoclonal antibody,clone 1H3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | HRP |
DDT mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
DDT mouse monoclonal antibody,clone OTI3A1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
DDT mouse monoclonal antibody,clone 3A1, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
DDT mouse monoclonal antibody,clone 3A1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
DDT mouse monoclonal antibody,clone OTI3A1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
DDT mouse monoclonal antibody,clone OTI1F12
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
DDT mouse monoclonal antibody,clone 1F12, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
DDT mouse monoclonal antibody,clone 1F12, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
DDT mouse monoclonal antibody,clone OTI1F12
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
DDT mouse monoclonal antibody,clone OTI2H3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
DDT mouse monoclonal antibody,clone 2H3, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
DDT mouse monoclonal antibody,clone 2H3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
DDT mouse monoclonal antibody,clone OTI2H3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |