Rabbit polyclonal Anti-DDX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX1 antibody: synthetic peptide directed towards the C terminal of human DDX1. Synthetic peptide located within the following region: SQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEK |
Rabbit Polyclonal Anti-DDX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX1 antibody: synthetic peptide directed towards the N terminal of human DDX1. Synthetic peptide located within the following region: ILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGA |
Rabbit Polyclonal Anti-DDX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX1 antibody: synthetic peptide directed towards the middle region of human DDX1. Synthetic peptide located within the following region: KGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANS |
DDX1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human DDX1 |
DDX1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DDX1 |
DDX1 Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 441-740 of human DDX1 (NP_004930.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
