Antibodies

View as table Download

Rabbit Polyclonal DDX41 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DDX41 antibody was raised against a 17 amino acid peptide near the amino terminus of human DDX41.

Rabbit Polyclonal Anti-DDX41 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX41 antibody: synthetic peptide directed towards the C terminal of human DDX41. Synthetic peptide located within the following region: AIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATDVASKGL

DDX41 Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region (QEERTKAIEAFRE)

Rabbit Polyclonal Anti-DDX41 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX41 antibody: synthetic peptide directed towards the N terminal of human DDX41. Synthetic peptide located within the following region: RGDEDDIPLGPQSNVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESV

DDX41 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified