Rabbit Polyclonal Anti-DDX47 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX47 antibody: synthetic peptide directed towards the C terminal of human DDX47. Synthetic peptide located within the following region: AQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR |
Rabbit Polyclonal Anti-DDX47 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX47 antibody: synthetic peptide directed towards the N terminal of human DDX47. Synthetic peptide located within the following region: MAAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKI |
Rabbit Polyclonal Anti-DDX47 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX47 antibody: synthetic peptide directed towards the N terminal of human DDX47. Synthetic peptide located within the following region: AAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQ |
Rabbit Polyclonal Anti-DDX47 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX47 antibody: synthetic peptide directed towards the N terminal of human DDX47. Synthetic peptide located within the following region: QLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETP |
DDX47 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DDX47 |
DDX47 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 186-455 of human DDX47 (NP_057439.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
