Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-DECR2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DECR2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Decr2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Decr2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTFPNGIKQLLE |
Rabbit Polyclonal Anti-DECR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DECR2 Antibody: synthetic peptide directed towards the N terminal of human DECR2. Synthetic peptide located within the following region: MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMR |
DECR2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DECR2 |
DECR2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human DECR2 (NP_065715.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DECR2