Antibodies

View as table Download

DEFB4A rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DEFB4A

Biotinylated Anti-Human BD-2 Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Immunogen E.coli derived Recombinant Human BD-2

Anti-Human BD-2 Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Immunogen E.coli derived Recombinant Human BD-2

Rabbit Polyclonal Anti-DEFB4A Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-DEFB4A antibody: synthetic peptide directed towards the N terminal of human DEFB4A. Synthetic peptide located within the following region: LLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGL

DEFB4A rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DEFB4A