DEFB4A rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DEFB4A |
DEFB4A rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DEFB4A |
Biotinylated Anti-Human BD-2 Goat Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Immunogen | E.coli derived Recombinant Human BD-2 |
Anti-Human BD-2 Goat Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Immunogen | E.coli derived Recombinant Human BD-2 |
Rabbit Polyclonal Anti-DEFB4A Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-DEFB4A antibody: synthetic peptide directed towards the N terminal of human DEFB4A. Synthetic peptide located within the following region: LLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGL |
DEFB4A rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DEFB4A |