Rabbit Polyclonal Anti-DESI2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DESI2 antibody is: synthetic peptide directed towards the C-terminal region of Human DESI2. Synthetic peptide located within the following region: SCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHT |
Rabbit Polyclonal PNAS4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PNAS4 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PNAS4. |
DESI2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human DESI2 (NP_057160.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China