Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-DGKA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKA. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-DGKA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKA antibody: synthetic peptide directed towards the N terminal of human DGKA. Synthetic peptide located within the following region: EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL |
Carrier-free (BSA/glycerol-free) DGKA mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
DGKA Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DGKA (NP_958852.1). |
| Modifications | Unmodified |
DGKA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DGKA (NP_958852.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
DGKA mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DGKA mouse monoclonal antibody, clone OTI4H10 (formerly 4H10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
DGKA mouse monoclonal antibody, clone OTI4H10 (formerly 4H10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
DGKA mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- DGKA