Antibodies

Jump to Filters
View as table Download
DGKH Rabbit Polyclonal Antibody
TA316184

USD 345.00

In Stock

Rabbit polyclonal anti-DGKH antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKH.
DGKH Rabbit Polyclonal Antibody
TA337747

USD 375.00

5 Days

Rabbit Polyclonal Anti-DGKH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: EPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQT
DGKH Rabbit Polyclonal Antibody
TA337746

USD 375.00

5 Days

Rabbit Polyclonal Anti-DGKH Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW