Antibodies

Jump to Filters
View as table Download
Deoxyguanosine kinase (DGUOK) Rabbit Polyclonal Antibody
TA337928

USD 375.00

5 Days

Rabbit Polyclonal Anti-DGUOK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGUOK antibody is: synthetic peptide directed towards the C-terminal region of Human DGUOK. Synthetic peptide located within the following region: EQLHGQHEAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMRE
Deoxyguanosine kinase (DGUOK) Rabbit Polyclonal Antibody
TA375442

USD 220.00

3 Weeks

DGUOK Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-277 of human DGUOK (NP_550438.1).
Modifications Unmodified