Rabbit Polyclonal Anti-DHDH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHDH antibody: synthetic peptide directed towards the middle region of human DHDH. Synthetic peptide located within the following region: PCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMK |
DHDH rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
DHDH Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-334 of human DHDH (NP_055290.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
