Germany
Japan
United Kingdom
China
DHPS rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal Anti-DHPS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHPS antibody: synthetic peptide directed towards the N terminal of human DHPS. Synthetic peptide located within the following region: TTGFQATNFGRAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIF |
Carrier-free (BSA/glycerol-free) DHPS mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DHPS Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DHPS |
DHPS rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DHPS |
DHPS Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-369 of human DHPS (NP_001921.1). |
| Modifications | Unmodified |
Anti-DHPS mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-DHPS mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Anti-DHPS mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Anti-DHPS mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- DHPS