DHRS7 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Gorilla, Horse, Human |
| Immunogen | DHRS7 antibody was raised against synthetic 18 amino acid peptide from internal region of human DHRS7. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bat, Horse (100%); Marmoset, Elephant, Pig (94%); Panda, Dog, Bovine, Rabbit, Turkey, Chicken, Xenopus (89%); Mouse, Rat, Stickleback, Zebrafish (83%). |
DHRS7 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Monkey, Mouse, Rabbit |
| Immunogen | DHRS7 antibody was raised against synthetic 15 amino acid peptide from internal region of human DHRS7. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit (100%); Rat, Hamster, Opossum (93%); Marmoset, Pig, Xenopus (87%); Sea anemone (80%). |
Rabbit Polyclonal Anti-Dhrs7 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dhrs7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MVVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNL |
DHRS7 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DHRS7 |
DHRS7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human DHRS7 |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
