Rabbit Polyclonal Anti-DIRAS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DIRAS2 Antibody is: synthetic peptide directed towards the C-terminal region of Human DIRAS2. Synthetic peptide located within the following region: TSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM |
Carrier-free (BSA/glycerol-free) DIRAS2 mouse monoclonal antibody,clone OTI10A6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DIRAS2 mouse monoclonal antibody,clone OTI10H1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
DIRAS2 mouse monoclonal antibody,clone OTI10A6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DIRAS2 mouse monoclonal antibody,clone OTI10A6, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
DIRAS2 mouse monoclonal antibody,clone OTI10A6, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
DIRAS2 mouse monoclonal antibody,clone OTI10A6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DIRAS2 mouse monoclonal antibody,clone OTI10H1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DIRAS2 mouse monoclonal antibody,clone OTI10H1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
DIRAS2 mouse monoclonal antibody,clone OTI10H1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
DIRAS2 mouse monoclonal antibody,clone OTI10H1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
