Antibodies

Jump to Filters
View as table Download
Dispatched (DISP1) Rabbit Polyclonal Antibody
TA320062

USD 430.00

2 Weeks

Rabbit Polyclonal DISP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DISP1 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human DISP1.
Dispatched (DISP1) Goat Polyclonal Antibody
TA305822

USD 375.00

5 Days

Goat Anti-Dispatched homolog 1 Antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SELSGESLLIKTL, from the C Terminus of the protein sequence according to NP_116279.2.
Dispatched (DISP1) Rabbit Polyclonal Antibody
TA339637

USD 375.00

5 Days

Rabbit Polyclonal Anti-DISP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DISP1 antibody: synthetic peptide directed towards the middle region of human DISP1. Synthetic peptide located within the following region: FVLCDVWNYTKFDKPHAETSETVSITLQHAALSMFVTSFTTAAAFYANYV
Dispatched (DISP1) Rabbit Polyclonal Antibody
TA375478

USD 220.00

3 Weeks

DISP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1325-1524 of human DISP1 (NP_116279.2).
Modifications Unmodified