Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-DKK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DKK1 antibody: synthetic peptide directed towards the C terminal of human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD |
DKK1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 64~93 amino acids from the N-terminal region of Human Dickkopf-1. |
Rabbit Polyclonal Anti-DKK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DKK1 antibody is: synthetic peptide directed towards the C-terminal region of Human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD |
Rabbit Polyclonal Anti-DKK1 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DKK1 antibody was raised against synthetic 15 amino acid peptide from 1st cytoplasmic domain of human DKK1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (93%); Marmoset (80%). |
Rabbit Polyclonal Anti-DKK1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | DKK1 antibody was raised against synthetic 16 amino acid peptide from internal region of human DKK1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset, Bat, Horse, Pig (100%); Galago, Sheep, Goat, Elephant, Bovine, Rabbit, Guinea pig (94%); Hamster, Panda, Dog (88%). |
Rabbit Polyclonal Anti-DKK1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | DKK1 antibody was raised against synthetic 16 amino acid peptide from N-terminus of human DKK1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Horse, Pig (100%); Gibbon, Mouse, Rat, Bat, Elephant (94%); Bovine, Hamster (88%); Panda, Rabbit (81%). |
Rabbit Polyclonal Anti-DKK1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | DKK1 antibody was raised against synthetic 14 amino acid peptide from N-Terminus of human DKK1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Baboon, Monkey, Galago (100%); Orangutan, Gibbon, Marmoset, Elephant, Bovine, Horse, Rabbit, Pig (93%); Rat, Bat (86%). |
Rabbit Polyclonal Anti-DKK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DKK1 |
DKK1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 71-266 of human DKK1 (NP_036374.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DKK1