Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against DLC1 (Isoforms 1 and 3)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SVAIRKRSWEEHC, from the N Terminus of the protein sequence according to NP_872584.1; NP_079043.2. |
Antibodies
View as table Download
Rabbit anti-DLC1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DLC1 |
Rabbit Polyclonal Anti-DLC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLC1 antibody: synthetic peptide directed towards the C terminal of human DLC1. Synthetic peptide located within the following region: NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL |
DLC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DLC1 |
Active filters
Target Symbol
- DLC1