Germany
Japan
United Kingdom
China
Rabbit Polyclonal SAP102 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Antibodies
View as table Download
Mouse Monoclonal Anti-SAP102 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SAP 102
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein of the sequence KSTPKLNGSGPSWW PECTCTNRDWYEQVNGSD, corresponding to amino acid residues 93-124 of human SAP102 (MW: 30 kDa.). N-terminal part. |
Rabbit Polyclonal Anti-DLG3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DLG3 Antibody: synthetic peptide directed towards the middle region of human DLG3. Synthetic peptide located within the following region: FPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQF |
Rabbit Polyclonal Anti-DLG3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DLG3 Antibody: synthetic peptide directed towards the N terminal of human DLG3. Synthetic peptide located within the following region: HEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSG |
Rabbit Polyclonal Anti-DLG3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dlg3 antibody is: synthetic peptide directed towards the middle region of Mouse Dlg3. Synthetic peptide located within the following region: FGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNL |
Dlg3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
DLG3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 464-817 of human DLG3 (NP_066943.2). |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- DLG3