Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-DLK1 antibody (CT)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | DLK1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human DLK1. |
Rabbit Polyclonal Anti-DLK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLK1 antibody: synthetic peptide directed towards the middle region of human DLK1. Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT |
DLK1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DLK1 |
DLK1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DLK1 |
| Modifications | Unmodified |
DLK1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 83-383 of human DLK1 (NP_003827.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DLK1