Rabbit Polyclonal Anti-Dnase1l1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dnase1l1 antibody is: synthetic peptide directed towards the middle region of Mouse Dnase1l1. Synthetic peptide located within the following region: ADCASLTKKRLKSLLLRTKAGFHWVIPDGEDTTVRASTNCTYDRIVVHGQ |
DNASE1L1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human DNASE1L1 |
DNASE1L1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DNASE1L1 |
DNASE1L1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-302 of human DNASE1L1 (NP_006721.1). |
| Modifications | Unmodified |
DNASE1L1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-302 of human DNASE1L1 (NP_006721.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
