Mouse Monoclonal DNMT3A Antibody (64B1446)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Mouse Monoclonal DNMT3A Antibody (64B1446)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-DNMT3A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DNMT3A antibody is: synthetic peptide directed towards the C-terminal region of Human DNMT3A. Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE |
Rabbit Polyclonal DNMT3A Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT3A antibody: human DNMT3A, (DNA methyltransferase 3A), using a KLH-conjugated synthetic peptide corresponding to amino acids 44-58. |
Rabbit Polyclonal DNMT3A Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT3A antibody: human DNMT3A, (DNA methyltransferase 3A), using a KLH-conjugated synthetic peptide corresponding to amino acids 92-106. |
Rabbit Polyclonal DNMT3A Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT3A antibody: human DNMT3A, (DNA methyltransferase 3A), using a KLH-conjugated synthetic peptide corresponding to amino acids 107-121. |
DNMT3A Rabbit Polyclonal Antibody
| Applications | ELISA, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against DNMT3a
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was raised against amino acids 10-118 of the human DNMT3a protein. |
Rabbit Polyclonal DNMT3A Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Immunogen | The immunogen for anti-DNMT3A antibody: mouse DNMT3 (DNA methyltransferase 3A), using two KLH-conjugated synthetic peptides containing an amino acid sequence from the central part of the protein. |
DNMT3A (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Central region of Human DNMT3A |
DNMT3A (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 871-900 amino acids from the C-terminal region of Human DNMT3A. |
Mouse Monoclonal DNMT3A Antibody (64B814.1)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal DNMT3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against synthetic peptides corresponding to areas around amino acids 125-175 and another around 175-225 of Dnmt3a. |
Rabbit Polyclonal DNMT3A Antibody
| Applications | WB |
| Reactivities | Human, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 10-50 of human Dnmt3a was used as the immunogen. |
Anti-DNMT3A Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha |
Anti-DNMT3A Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha |
Rabbit Polyclonal Anti-DNMT3A Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DNMT3A |
DNMT3A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DNMT3A |
DNMT3A Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
DNMT3A Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DNMT3A Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Dnmt3a Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |