Germany
Japan
United Kingdom
China
Rabbit Polyclonal TdT Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
TdT (DNTT) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human TDT |
Rabbit Polyclonal Anti-DNTT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNTT antibody: synthetic peptide directed towards the N terminal of human DNTT. Synthetic peptide located within the following region: FQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSG |
Rabbit Polyclonal Anti-DNTT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNTT antibody: synthetic peptide directed towards the middle region of human DNTT. Synthetic peptide located within the following region: LRRYATHERKMILDNHALYDKTKRIFLKAESEEEIFAHLGLDYIEPWERN |
TdT (DNTT) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 445-475 amino acids from the C-terminal region of human TdT |
Terminal Deoxynucleotidyl Transferase Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
DNTT rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DNTT |
DNTT Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 260-509 of human DNTT (NP_004079.3). |
| Modifications | Unmodified |
DNA Nucleotidylexotransferase Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human TDT |
Active filters
Target Symbol
- DNTT