Antibodies

View as table Download

Rabbit anti-DOK4 Polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-DOK4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DOK4 antibody: synthetic peptide directed towards the C terminal of human DOK4. Synthetic peptide located within the following region: GSQNIAEASSYAGEGYGAAQASSETDLLNRFILLKPKPSQGDSSEAKTPS

Rabbit polyclonal anti-DOK4 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DOK4.

Rabbit Polyclonal Anti-DOK4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DOK4 antibody: synthetic peptide directed towards the N terminal of human DOK4. Synthetic peptide located within the following region: GPQRLEKYPDEKSVCLRGCPKVTEISNVKCVTRLPKETKRQAVAIIFTDD

Rabbit Polyclonal Anti-DOK4 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DOK4

DOK4 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

DOK4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DOK4

DOK4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein