Rabbit Polyclonal Anti-DPH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DPH1 antibody: synthetic peptide directed towards the middle region of human DPH1. Synthetic peptide located within the following region: RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV |
OVCA1 (DPH1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 383-412 amino acids from the C-terminal region of Human DPH1 |
Rabbit Polyclonal Anti-DPH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DPH1 antibody: synthetic peptide directed towards the N terminal of human DPH1. Synthetic peptide located within the following region: NQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQQAQAKKVALQMPEG |
Germany
Japan
United Kingdom
China
