Rabbit Polyclonal Anti-DPYSL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DPYSL3 antibody: synthetic peptide directed towards the middle region of human DPYSL3. Synthetic peptide located within the following region: VFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSA |
Anti-CRMP4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 507-523 amino acids of Human Collapsin response mediator protein 4 |
Rabbit Polyclonal Anti-DPYSL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DPYSL3 |
DPYSL3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DPYSL3 |
DPYSL3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DPYSL3 |
DPYSL3 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
