Antibodies

View as table Download

Rabbit Polyclonal DRAM Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DRAM antibody was raised against a 16 amino acid synthetic peptide from near the amino terminus of human DRAM. The immunogen is located within amino acids 30 - 80 of DRAM.

Rabbit Polyclonal Anti-DRAM Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DRAM antibody: synthetic peptide directed towards the N terminal of human DRAM. Synthetic peptide located within the following region: TMYTRYKIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVP

Rabbit Polyclonal DRAM Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DRAM antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human DRAM.

Dram1 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

DRAM1 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated
Modifications Unmodified