Antibodies

Jump to Filters
View as table Download
NC2 alpha (DRAP1) Rabbit Polyclonal Antibody
TA329305

USD 375.00

5 Days

Rabbit Polyclonal anti-DRAP1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DRAP1 antibody: synthetic peptide directed towards the N terminal of human DRAP1. Synthetic peptide located within the following region: MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLL
NC2 alpha (DRAP1) Rabbit Polyclonal Antibody
TA375617

USD 220.00

3 Weeks

DRAP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human DRAP1 (NP_006433.2).
Modifications Unmodified