Rabbit Polyclonal Anti-RNASEN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNASEN antibody: synthetic peptide directed towards the middle region of human RNASEN. Synthetic peptide located within the following region: AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK |
Goat Polyclonal Antibody against RNASEN
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KQTDKQKLAQRE, from the internal region of the protein sequence according to NP_081075.2. |
DROSHA Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DROSHA |
DROSHA Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DROSHA |
DROSHA rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DROSHA |
DROSHA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DROSHA (NP_037367.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China