Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-DSG1 antibody
| Applications | WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DSG1. |
Antibodies
View as table Download
Desmoglein 1 (DSG1) (841-855) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | Synthetic peptide from an internal region of human DSG1 (NP_001933.2) |
Desmoglein 1 (DSG1) mouse monoclonal antibody, clone Dsg1-P23, Supernatant
| Applications | IHC, WB |
| Reactivities | Human |
Desmoglein 1 (DSG1) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001933.2. |
Rabbit Polyclonal Anti-DSG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DSG1 antibody is: synthetic peptide directed towards the C-terminal region of Human DSG1. Synthetic peptide located within the following region: GGIGLSSLGGTASIGHMRSSSDHHFNQTIGSASPSTARSRITKYSTVQYS |
Mouse monoclonal Anti-Desmoglein Clone 32-2B
| Reactivities | Bovine, Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-DSG1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DSG1 |
DSG1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 800-1049 of human DSG1 (NP_001933.2). |
| Modifications | Unmodified |
Rabbit Polyclonal anti-DSG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DSG1 |
Rabbit Polyclonal anti-DSG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DSG1 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- DSG1