CDT2 (DTL) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 229-256 amino acids from the Central region of Human DTL. |
CDT2 (DTL) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 229-256 amino acids from the Central region of Human DTL. |
Rabbit Polyclonal Anti-DTL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DTL antibody: synthetic peptide directed towards the N terminal of human DTL. Synthetic peptide located within the following region: VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV |
DTL rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DTL |
DTL rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DTL |
DTL Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 541-730 of human DTL (NP_057532.3). |
Modifications | Unmodified |
CDT2 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human CDT2 |
CDT2 Rabbit monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |