Rabbit Polyclonal Anti-Dusp11 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dusp11 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLII |
Rabbit Polyclonal Anti-Dusp11 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Dusp11 antibody is: synthetic peptide directed towards the middle region of Mouse Dusp11. Synthetic peptide located within the following region: AFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLIIDLTYTQRYYK |
DUSP11 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human DUSP11 |
Germany
Japan
United Kingdom
China
