Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal DVL1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DVL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 442-470 amino acids from the Central region of human DVL1. |
Rabbit Polyclonal Anti-DVL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DVL1 antibody: synthetic peptide directed towards the middle region of human DVL1. Synthetic peptide located within the following region: LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK |
Dvl1 Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Pig |
| Conjugation | Unconjugated |
| Immunogen | N Terminus (KLPVAPERVTLAD) |
Rabbit Polyclonal Anti-DVL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DVL1 antibody: synthetic peptide directed towards the C terminal of human DVL1. Synthetic peptide located within the following region: AAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPP |
DVL1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 510-640 of human DVL1 (NP_004412.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DVL1